Project name: d4cdcabfe2d274e [mutate: PA15S]

Status: done

submitted: 2021-08-10 03:52:47, status changed: 2021-08-10 03:59:01
Settings
Chain sequence(s) A: YTPNDPYFSSRQYGPQKIQAPQAWDIAEGSGAKIAIVDTGVQSNHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAGIAAAVTNNSTGIAGTAPKASILAVRVLDNSGSGTWTAVANGITYAADQGAKVISLSLGGTVGNSGLQQAVNYAWNKGSVVVAAAGNAGNTAPNYPAYYSNAIAVASTDQNDNKSSFSTYGSWVDVAAPGSSIYSTYPTSTYASLSGTSMATPHVAGVAGLLASQGRSASNIRAAIENTADKISGTGTYWAKGRVNAYKAVQY
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues PA15S
Energy difference between WT (input) and mutated protein (by FoldX) 4.3236 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.7932
Maximal score value
1.5383
Average score
-0.4868
Total score value
-135.8103

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A -0.0464
2 T A -0.5639
3 P A 0.0000
4 N A -1.8124
5 D A 0.0000
6 P A -0.9735
7 Y A -0.7223
8 F A 0.0000
9 S A -0.9768
10 S A -1.0999
11 R A -1.8252
12 Q A -1.2231
13 Y A -0.9584
14 G A 0.0000
15 S A 0.0000 mutated: PA15S
16 Q A -1.0837
17 K A -1.3093
18 I A 0.0000
19 Q A -0.9555
20 A A 0.0000
21 P A -0.6579
22 Q A -1.0439
23 A A 0.0000
24 W A 0.0000
25 D A -1.2039
26 I A 0.1637
27 A A 0.0000
28 E A -1.0667
29 G A 0.0000
30 S A -1.3083
31 G A -1.2719
32 A A 0.0000
33 K A -0.9667
34 I A 0.0000
35 A A 0.0000
36 I A 0.0000
37 V A 0.0000
38 D A 0.0000
39 T A 0.0000
40 G A 0.0000
41 V A 0.0000
42 Q A -0.9894
43 S A -0.9005
44 N A -1.6118
45 H A 0.0000
46 P A -0.6684
47 D A 0.0000
48 L A 0.0000
49 A A -0.4733
50 G A -0.3018
51 K A -0.1942
52 V A 0.6056
53 V A 1.5379
54 G A 0.5342
55 G A 0.0630
56 W A -0.4765
57 D A 0.0000
58 F A -0.7845
59 V A -0.8629
60 D A -2.2839
61 N A -2.1647
62 D A -1.9491
63 S A -1.1767
64 T A -1.1847
65 P A -1.1697
66 Q A -1.8576
67 N A -1.5082
68 G A -1.7425
69 N A -1.7333
70 G A 0.0000
71 H A -0.5383
72 G A 0.0000
73 T A 0.0000
74 H A 0.0000
75 C A 0.0000
76 A A 0.0000
77 G A 0.0000
78 I A 0.0000
79 A A 0.0000
80 A A 0.0000
81 A A 0.0000
82 V A -0.4707
83 T A -1.0454
84 N A -1.7669
85 N A -1.3268
86 S A -1.1470
87 T A -0.6551
88 G A 0.0000
89 I A 0.0000
90 A A 0.0000
91 G A 0.0000
92 T A 0.0000
93 A A 0.0000
94 P A 0.0000
95 K A -1.9138
96 A A 0.0000
97 S A -0.3439
98 I A 0.0000
99 L A 0.0000
100 A A 0.0000
101 V A 0.0000
102 R A 0.0000
103 V A 0.0000
104 L A 0.0000
105 D A -1.8683
106 N A -2.3137
107 S A -1.5144
108 G A -1.3524
109 S A -1.1026
110 G A -0.8026
111 T A -0.1878
112 W A -0.3670
113 T A -0.4137
114 A A -0.3384
115 V A 0.0000
116 A A -0.9518
117 N A -1.0325
118 G A 0.0000
119 I A 0.0000
120 T A -1.1933
121 Y A -0.9174
122 A A 0.0000
123 A A -1.8147
124 D A -2.3533
125 Q A -1.8754
126 G A -1.7396
127 A A 0.0000
128 K A -1.7692
129 V A 0.0000
130 I A 0.0000
131 S A 0.0000
132 L A 0.0000
133 S A 0.0000
134 L A -0.1233
135 G A -0.1442
136 G A 0.1761
137 T A 0.6941
138 V A 1.5383
139 G A 0.3232
140 N A -0.7158
141 S A -1.1955
142 G A -1.3544
143 L A 0.0000
144 Q A -1.6092
145 Q A -1.8323
146 A A 0.0000
147 V A 0.0000
148 N A -1.5533
149 Y A -1.4071
150 A A 0.0000
151 W A -1.3806
152 N A -2.1697
153 K A -2.7932
154 G A -1.7362
155 S A 0.0000
156 V A 0.0000
157 V A 0.0000
158 V A 0.0000
159 A A 0.0000
160 A A 0.0000
161 A A 0.0000
162 G A 0.0000
163 N A -1.3467
164 A A -0.8000
165 G A -0.8041
166 N A -0.8540
167 T A -0.2935
168 A A 0.0457
169 P A 0.3479
170 N A 0.2583
171 Y A 0.4815
172 P A 0.0000
173 A A 0.0000
174 Y A 0.8657
175 Y A 0.1624
176 S A -0.2017
177 N A -0.5497
178 A A 0.0000
179 I A 0.0000
180 A A 0.0000
181 V A 0.0000
182 A A 0.0000
183 S A 0.0000
184 T A 0.0000
185 D A -2.0538
186 Q A -2.5058
187 N A -2.6081
188 D A -2.1022
189 N A -2.3099
190 K A -1.2143
191 S A 0.0000
192 S A -0.5931
193 F A -0.3429
194 S A 0.0000
195 T A 0.0000
196 Y A -0.0073
197 G A 0.0000
198 S A -0.2104
199 W A 0.2321
200 V A 0.0000
201 D A -0.3196
202 V A 0.0000
203 A A 0.0000
204 A A 0.0000
205 P A 0.0000
206 G A 0.0000
207 S A -0.6081
208 S A -0.6010
209 I A 0.0000
210 Y A -0.1836
211 S A 0.0000
212 T A 0.0000
213 Y A 0.1519
214 P A -0.3616
215 T A -0.3375
216 S A -0.3992
217 T A 0.0195
218 Y A 0.2825
219 A A 0.1987
220 S A -0.1895
221 L A 0.2070
222 S A -0.2388
223 G A 0.0000
224 T A 0.0000
225 S A -0.2164
226 M A 0.0000
227 A A 0.0000
228 T A 0.0000
229 P A 0.0000
230 H A 0.0000
231 V A 0.0000
232 A A 0.0000
233 G A 0.0000
234 V A 0.0000
235 A A 0.0000
236 G A 0.0000
237 L A 0.0000
238 L A 0.0000
239 A A -0.9944
240 S A -1.1274
241 Q A -0.7704
242 G A -1.0093
243 R A -0.9929
244 S A -1.0065
245 A A -1.2010
246 S A -0.8178
247 N A -0.8093
248 I A 0.0000
249 R A -0.8069
250 A A -0.6570
251 A A 0.0000
252 I A 0.0000
253 E A -1.1985
254 N A -1.4714
255 T A -1.1684
256 A A 0.0000
257 D A -1.5024
258 K A -1.9923
259 I A -1.2138
260 S A -0.9001
261 G A -0.7172
262 T A -0.9105
263 G A -0.8256
264 T A -0.2045
265 Y A 0.0722
266 W A 0.0000
267 A A -0.6789
268 K A -1.4469
269 G A 0.0000
270 R A 0.0000
271 V A 0.0000
272 N A 0.0000
273 A A 0.0000
274 Y A -0.5294
275 K A -1.0560
276 A A 0.0000
277 V A 0.0000
278 Q A -0.5564
279 Y A 0.2804

 

Laboratory of Theory of Biopolymers 2015