Project name: SH3_S134Y

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134Y
Energy difference between WT (input) and mutated protein (by FoldX)	-0.848052 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4708
• Maximal score value: 1.2494
• Average score: -0.857
• Total score value: -51.4226

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0874
87	V	A	-0.5998
88	A	A	0.0000
89	L	A	-0.2577
90	Y	A	-0.6601
91	D	A	-2.8140
92	Y	A	-2.0836
93	E	A	-2.8819
94	S	A	0.0000
95	R	A	-2.7835
96	T	A	-2.1532
97	E	A	-2.3518
98	T	A	-1.2397
99	D	A	-1.3247
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4708
104	K	A	-2.8274
105	G	A	-1.9517
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2442
110	I	A	0.5013
111	V	A	1.2494
112	N	A	-0.4209
113	N	A	-1.7392
114	T	A	-1.7348
115	E	A	-2.8706
116	G	A	-2.4932
117	D	A	-2.5094
118	W	A	-1.1573
119	W	A	-0.5634
120	L	A	0.4655
121	A	A	0.0000
122	H	A	-0.3845
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4117
129	T	A	-0.4933
130	G	A	0.0000
131	Y	A	0.2894
132	I	A	0.0000
133	P	A	-0.2563
134	Y	A	-0.6973	mutated: SA134Y
135	N	A	-0.9285
136	Y	A	0.0776
137	V	A	0.0000
138	A	A	0.0881
139	P	A	-0.1471
140	S	A	-0.1735