Project name: SH3_V111W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA111W
Energy difference between WT (input) and mutated protein (by FoldX)	-0.59419 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.8319
• Average score: -0.8968
• Total score value: -53.8094

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4876
82	S	A	-0.6352
83	H	A	-0.7567
84	M	A	0.3277
85	T	A	0.0000
86	F	A	-0.0265
87	V	A	-0.5814
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1605
97	E	A	-2.3591
98	T	A	-1.2533
99	D	A	-1.3444
100	L	A	0.0000
101	S	A	-1.9066
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-1.9878
108	L	A	0.0000
109	Q	A	-0.0481
110	I	A	0.3543
111	W	A	0.8319	mutated: VA111W
112	N	A	-0.5225
113	N	A	-1.8865
114	T	A	-1.7577
115	E	A	-2.9118
116	G	A	-2.5932
117	D	A	-2.6907
118	W	A	-1.3420
119	W	A	-0.7861
120	L	A	0.2929
121	A	A	0.0000
122	H	A	-0.2999
123	S	A	0.0000
124	L	A	-0.1623
125	T	A	-0.7545
126	T	A	-0.8465
127	G	A	-0.7654
128	Q	A	-1.3593
129	T	A	-0.4704
130	G	A	0.0000
131	Y	A	0.1239
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2960
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1184
140	S	A	-0.1759