Project name: SH3_S134D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134D
Energy difference between WT (input) and mutated protein (by FoldX)	1.34661 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5021
• Maximal score value: 1.2753
• Average score: -0.934
• Total score value: -56.0398

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4459
82	S	A	-0.6780
83	H	A	-0.7912
84	M	A	0.2716
85	T	A	0.0000
86	F	A	-0.1021
87	V	A	-0.6339
88	A	A	0.0000
89	L	A	-0.3478
90	Y	A	-0.8084
91	D	A	-2.8879
92	Y	A	-2.1231
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1552
97	E	A	-2.3537
98	T	A	-1.2439
99	D	A	-1.3293
100	L	A	0.0000
101	S	A	-1.9048
102	F	A	0.0000
103	K	A	-3.5021
104	K	A	-2.8918
105	G	A	-1.9760
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2276
110	I	A	0.4147
111	V	A	1.2753
112	N	A	-0.3950
113	N	A	-1.8841
114	T	A	-1.7304
115	E	A	-3.0063
116	G	A	-2.7332
117	D	A	-2.8755
118	W	A	-1.5393
119	W	A	-0.8648
120	L	A	0.3405
121	A	A	0.0000
122	H	A	-0.3747
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4924
130	G	A	0.0000
131	Y	A	0.1336
132	I	A	0.0000
133	P	A	0.0000
134	D	A	-1.8757	mutated: SA134D
135	N	A	-1.5457
136	Y	A	-0.4135
137	V	A	0.0000
138	A	A	-0.1143
139	P	A	-0.1489
140	S	A	-0.1781