Project name: SH3_W119D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119D
Energy difference between WT (input) and mutated protein (by FoldX)	5.37842 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2101
• Average score: -0.9104
• Total score value: -54.6249

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4480
82	S	A	-0.6799
83	H	A	-0.7912
84	M	A	0.2917
85	T	A	0.0000
86	F	A	0.0485
87	V	A	-0.5146
88	A	A	0.0000
89	L	A	-0.2394
90	Y	A	-0.7045
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1620
97	E	A	-2.3606
98	T	A	-1.2566
99	D	A	-1.3931
100	L	A	0.0000
101	S	A	-1.9134
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8367
105	G	A	-1.9280
106	E	A	0.0000
107	R	A	-2.0200
108	L	A	0.0000
109	Q	A	-0.2042
110	I	A	0.4241
111	V	A	1.2101
112	N	A	-0.4891
113	N	A	-1.9376
114	T	A	-1.7908
115	E	A	-3.0241
116	G	A	-2.6930
117	D	A	-2.7978
118	W	A	-1.5648
119	D	A	-1.0714	mutated: WA119D
120	L	A	0.2359
121	A	A	0.0000
122	H	A	-0.4160
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5014
130	G	A	0.0000
131	Y	A	0.0346
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3762
135	N	A	-1.2473
136	Y	A	-0.1166
137	V	A	-0.0327
138	A	A	0.0963
139	P	A	-0.0640
140	S	A	-0.1171