Project name: knob and hole [mutate: SB26E]

Status: done

submitted: 2019-04-03 02:31:34, status changed: 2019-04-03 02:45:45
Settings
Chain sequence(s) A: GQPREPQVYTLPPCQEEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS
B: GQPREPQVYTLPPCQEEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS
Distance of aggregation 5 Å
Dynamic mode No
Mutated residues SB26E
Energy difference between WT (input) and mutated protein (by FoldX) -1.67059 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.0941
Maximal score value
1.5741
Average score
-0.3932
Total score value
-81.7878

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.6876
2 Q A -1.2962
3 P A -0.5094
4 R A -1.7607
5 E A -2.0861
6 P A 0.0000
7 Q A -0.5659
8 V A 0.0000
9 Y A 0.0000
10 T A 0.0000
11 L A 0.0000
12 P A -0.1123
13 P A -0.0392
14 C A -0.1375
15 Q A -1.5131
16 E A -2.0375
17 E A 0.0000
18 M A 0.2373
19 T A -0.3349
20 K A -1.9428
21 N A -1.6976
22 Q A -0.9862
23 V A 0.0000
24 S A 0.0000
25 L A 0.0000
26 W A 0.0000
27 C A 0.0000
28 L A 0.0000
29 V A 0.0000
30 K A -0.2194
31 G A -0.1548
32 F A 0.0000
33 Y A 0.1972
34 P A 0.0100
35 S A -0.4183
36 D A -1.7360
37 I A 0.0481
38 A A 0.0957
39 V A 0.0000
40 E A -1.1094
41 W A 0.0000
42 E A -0.4174
43 S A 0.0000
44 N A -1.3569
45 G A -0.9146
46 Q A -1.3289
47 P A -0.5574
48 E A -0.5054
49 N A -1.4178
50 N A -0.7480
51 Y A 0.0812
52 K A -0.3517
53 T A -0.0945
54 T A 0.0000
55 P A -0.1716
56 P A -0.0746
57 V A 0.4149
58 L A 1.1912
59 D A -0.1652
60 S A -0.6000
61 D A -1.8933
62 G A -0.6879
63 S A -0.0463
64 F A 0.3675
65 F A 0.0000
66 L A 0.0000
67 Y A 0.0000
68 S A 0.0000
69 R A 0.0000
70 L A 0.0000
71 T A -0.0096
72 V A 0.0000
73 D A -1.0619
74 K A -0.7273
75 S A -0.3859
76 R A -0.4676
77 W A 0.0000
78 Q A -1.5245
79 E A -2.0656
80 G A -0.5435
81 N A 0.0124
82 V A 1.4570
83 F A 0.0000
84 S A 0.0000
85 C A 0.0000
86 S A 0.0000
87 V A 0.0000
88 M A 0.3845
89 H A 0.0000
90 E A -1.9200
91 A A -0.4792
92 L A -0.1252
93 H A -1.1882
94 N A -1.6291
95 H A -1.2829
96 Y A 0.4237
97 T A -0.0652
98 Q A -0.9034
99 K A -0.5417
100 S A -0.2396
101 L A 0.1268
102 S A 0.1788
103 L A 0.3787
104 S A -0.1321
1 G B -0.6887
2 Q B -1.3038
3 P B -0.3781
4 R B -0.8189
5 E B -1.9110
6 P B 0.0000
7 Q B -0.5073
8 V B 0.0000
9 Y B 0.0000
10 T B 0.0000
11 L B 0.0000
12 P B -0.1201
13 P B -0.0362
14 C B -0.1388
15 Q B -1.4237
16 E B -1.5492
17 E B 0.0000
18 M B 0.1999
19 T B -0.3370
20 K B -1.9406
21 N B -1.7111
22 Q B -1.1567
23 V B 0.0000
24 S B 0.0000
25 L B 0.0000
26 E B 0.0000 mutated: SB26E
27 C B 0.0000
28 A B 0.0000
29 V B 0.0000
30 K B -0.2666
31 G B -0.1089
32 F B 0.0000
33 Y B 0.2468
34 P B 0.0146
35 S B -0.4020
36 D B -1.7329
37 I B 0.0459
38 A B 0.1381
39 V B 0.0000
40 E B -1.1810
41 W B 0.0000
42 E B -0.5187
43 S B -0.3385
44 N B -1.3613
45 G B -0.9133
46 Q B -1.3294
47 P B -0.5834
48 E B -0.5612
49 N B -1.5034
50 N B -1.2122
51 Y B -0.0625
52 K B -0.7838
53 T B -0.1729
54 T B 0.0000
55 P B -0.1765
56 P B -0.0880
57 V B 0.4805
58 L B 1.5741
59 D B 0.0132
60 S B -0.5829
61 D B -1.8989
62 G B -0.7130
63 S B 0.0000
64 F B 0.4285
65 F B 0.0000
66 L B 0.0000
67 V B 0.0000
68 S B 0.0000
69 R B 0.0000
70 L B 0.0000
71 T B -0.0109
72 V B 0.0000
73 D B -1.8027
74 K B -0.7748
75 S B -0.5184
76 R B -1.2861
77 W B 0.0000
78 Q B -1.5649
79 E B -2.0941
80 G B -0.7891
81 N B -0.0384
82 V B 1.1086
83 F B 0.0000
84 S B 0.0000
85 C B 0.0000
86 S B 0.0000
87 V B 0.0000
88 M B 0.4901
89 H B 0.0000
90 E B -1.6815
91 A B -0.4691
92 L B -0.1371
93 H B -1.1891
94 N B -1.6280
95 H B -1.1001
96 Y B 0.4018
97 T B -0.0681
98 Q B -0.9435
99 K B -0.7370
100 S B -0.2836
101 L B 0.0000
102 S B 0.1894
103 L B 0.9099
104 S B -0.0363

 

Laboratory of Theory of Biopolymers 2015