Project name: d7dd3268ca7009c

Status: done

submitted: 2021-09-19 16:07:20, status changed: 2021-09-19 16:12:58
Settings
Chain sequence(s) A: MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.5448
Maximal score value
2.7786
Average score
-0.8262
Total score value
-83.4493

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2373
2 Q A -0.4430
3 F A -0.9570
4 K A -0.7898
5 V A 0.0000
6 Y A -1.3807
7 T A -1.6715
8 Y A -2.5668
9 K A -2.9775
10 R A -3.2837
11 E A -3.5448
12 S A -2.8026
13 R A -2.5577
14 Y A -1.9087
15 R A -2.8145
16 L A 0.0000
17 F A 0.0000
18 V A 0.0000
19 D A 0.0000
20 V A -0.1900
21 Q A -0.0379
22 S A 0.1074
23 D A -0.4921
24 I A 1.5086
25 I A 1.1045
26 D A -1.1111
27 T A -1.0153
28 P A -0.8870
29 G A -0.7937
30 R A -1.1371
31 R A -0.4987
32 M A 0.0918
33 V A 0.0000
34 I A 0.0000
35 P A 0.0000
36 L A 0.0000
37 A A 0.0000
38 S A -0.5693
39 A A -0.7942
40 R A -1.3190
41 L A 0.7221
42 L A 0.2124
43 S A -1.0406
44 D A -2.6658
45 K A -2.5408
46 V A -1.4321
47 S A -1.8847
48 R A -2.9762
49 E A -2.6780
50 L A -1.2847
51 Y A -0.9122
52 P A 0.0000
53 V A -0.6618
54 V A 0.0000
55 H A -1.7328
56 I A -1.4535
57 G A -1.6628
58 D A -2.7344
59 E A -2.6855
60 S A -1.7371
61 W A 0.0000
62 R A 0.0000
63 M A 0.0000
64 M A 0.0622
65 T A 0.0000
66 T A -0.0148
67 D A -0.7577
68 M A -0.0776
69 A A -0.0506
70 S A -0.0364
71 V A 0.0000
72 P A 0.0787
73 V A 0.7683
74 S A -0.0047
75 V A -0.8166
76 I A -0.6177
77 G A -1.6110
78 E A -2.5592
79 E A -2.2759
80 V A -0.6660
81 A A -1.1750
82 D A -2.0112
83 L A 0.0000
84 S A -2.0531
85 H A -2.3131
86 R A -2.5538
87 E A -3.1811
88 N A -3.1846
89 D A -3.0986
90 I A 0.0000
91 K A -2.4322
92 N A -2.6931
93 A A 0.0000
94 I A -0.0681
95 N A 0.2532
96 L A 1.0775
97 M A 1.5238
98 F A 2.7786
99 W A 2.5332
100 G A 1.9215
101 I A 2.4484

 

Laboratory of Theory of Biopolymers 2015