Project name: SH3_Y131A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131A
Energy difference between WT (input) and mutated protein (by FoldX)	1.38129 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.025
• Average score: -0.9361
• Total score value: -56.1661

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1029
93	E	A	-2.8836
94	S	A	0.0000
95	R	A	-2.7844
96	T	A	-2.2083
97	E	A	-2.4073
98	T	A	-1.3330
99	D	A	-1.4786
100	L	A	0.0000
101	S	A	-1.9723
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2731
110	I	A	0.3056
111	V	A	1.0250
112	N	A	-0.9070
113	N	A	-2.0442
114	T	A	-1.8436
115	E	A	-2.9706
116	G	A	-2.6388
117	D	A	-2.6951
118	W	A	-1.4009
119	W	A	-0.8452
120	L	A	0.2943
121	A	A	0.0000
122	H	A	-0.4509
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.5366
130	G	A	0.0000
131	A	A	-0.1958	mutated: YA131A
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2896
135	N	A	-1.2349
136	Y	A	-0.1910
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759