Project name: SH3_E115G

Status: done

submitted: 2019-03-14 15:28:26, status changed: 2019-03-14 17:29:07
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues EA115G
Energy difference between WT (input) and mutated protein (by FoldX) 0.57699 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.2589
Average score
-0.7973
Total score value
-47.8353

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1552
97 E A -2.3537
98 T A -1.2439
99 D A -1.3229
100 L A 0.0000
101 S A -1.9048
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2465
110 I A 0.4421
111 V A 1.2589
112 N A -0.1174
113 N A -1.2532
114 T A -0.9387
115 G A -1.3079 mutated: EA115G
116 G A -1.8103
117 D A -2.2050
118 W A -0.8640
119 W A -0.2880
120 L A 0.6136
121 A A 0.0000
122 H A -0.3830
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4967
130 G A 0.0000
131 Y A 0.2223
132 I A 0.0000
133 P A 0.0000
134 S A -1.0865
135 N A -1.2436
136 Y A -0.2003
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015