Project name: SH3_K103P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	KA103P
Energy difference between WT (input) and mutated protein (by FoldX)	3.40132 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -2.9363
• Maximal score value: 1.2498
• Average score: -0.8057
• Total score value: -48.3447

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.4631
88	A	A	0.0000
89	L	A	-0.0755
90	Y	A	-0.3616
91	D	A	-2.2024
92	Y	A	-1.7297
93	E	A	-2.6546
94	S	A	0.0000
95	R	A	-2.7830
96	T	A	-2.1535
97	E	A	-2.3526
98	T	A	-1.2409
99	D	A	-1.3218
100	L	A	0.0000
101	S	A	-1.5963
102	F	A	0.0000
103	P	A	-2.0028	mutated: KA103P
104	K	A	-2.1342
105	G	A	-1.5800
106	E	A	0.0000
107	R	A	-1.9127
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3863
123	S	A	0.0000
124	L	A	-0.2868
125	T	A	-0.6262
126	T	A	-0.7271
127	G	A	-0.8224
128	Q	A	-1.4146
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2203
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759