Project name: SH3_L124T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124T
Energy difference between WT (input) and mutated protein (by FoldX)	1.07219 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1932
• Average score: -0.9597
• Total score value: -57.5816

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4675
82	S	A	-0.7047
83	H	A	-0.8071
84	M	A	0.2383
85	T	A	0.0000
86	F	A	-0.1409
87	V	A	-0.6411
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9620
106	E	A	0.0000
107	R	A	-2.4035
108	L	A	0.0000
109	Q	A	-0.6200
110	I	A	0.3483
111	V	A	1.1932
112	N	A	-0.4451
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.7053
120	L	A	0.3698
121	A	A	0.0000
122	H	A	-0.7535
123	S	A	0.0000
124	T	A	-1.2714	mutated: LA124T
125	T	A	-1.2494
126	T	A	-1.1677
127	G	A	-1.1366
128	Q	A	-1.5978
129	T	A	-0.6584
130	G	A	0.0000
131	Y	A	0.2097
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1656
140	S	A	-0.1759