Project name: SH3_N112W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA112W
Energy difference between WT (input) and mutated protein (by FoldX)	1.25723 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2899
• Average score: -0.8391
• Total score value: -50.3487

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5475
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1655
97	E	A	-2.3642
98	T	A	-1.2725
99	D	A	-1.3757
100	L	A	0.0000
101	S	A	-1.9178
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2594
110	I	A	0.5269
111	V	A	1.2899
112	W	A	0.9118	mutated: NA112W
113	N	A	-1.1705
114	T	A	-1.3157
115	E	A	-2.6463
116	G	A	-2.4413
117	D	A	-2.7092
118	W	A	-1.1747
119	W	A	-0.3806
120	L	A	0.7158
121	A	A	0.0000
122	H	A	-0.3989
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.6198
130	G	A	0.0000
131	Y	A	0.2374
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3121
135	N	A	-1.2524
136	Y	A	-0.2068
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759