Project name: test [mutate: AA65L, KA66P, GA67V, TA69R]

Chain sequence(s)	A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	AA65L, KA66P, GA67V, TA69R
Energy difference between WT (input) and mutated protein (by FoldX)	2.07019 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.2197
• Maximal score value: 0.8133
• Average score: -1.0382
• Total score value: -102.7863

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	I	A	-0.7740
2	D	A	-1.8861
3	V	A	0.0000
4	L	A	-0.3222
5	L	A	0.0000
6	G	A	0.0000
7	A	A	-1.3621
8	D	A	-2.7058
9	D	A	-2.8786
10	G	A	-1.8317
11	S	A	-0.9393
12	L	A	-0.1153
13	A	A	0.1432
14	F	A	0.0000
15	V	A	-0.0200
16	P	A	-0.4376
17	S	A	-0.6930
18	E	A	-1.9177
19	F	A	-0.8185
20	S	A	-1.1186
21	I	A	0.0000
22	S	A	-1.6823
23	P	A	-1.8587
24	G	A	-1.4459
25	E	A	-1.7450
26	K	A	-2.6359
27	I	A	0.0000
28	V	A	-1.9452
29	F	A	0.0000
30	K	A	-1.1081
31	N	A	0.0000
32	N	A	-0.4417
33	A	A	-0.5666
34	G	A	-0.5659
35	F	A	0.4578
36	P	A	-0.0523
37	H	A	0.0000
38	N	A	0.0000
39	I	A	0.0000
40	V	A	0.0000
41	F	A	0.0000
42	D	A	-2.1230
43	E	A	-3.1941
44	D	A	-2.9228
45	S	A	-2.1398
46	I	A	-2.0858
47	P	A	-1.7363
48	S	A	-1.2536
49	G	A	-0.7999
50	V	A	-1.2488
51	D	A	-1.9146
52	A	A	-2.0043
53	S	A	-1.5917
54	K	A	-2.0627
55	I	A	0.0000
56	S	A	-1.4718
57	M	A	-1.1248
58	S	A	-1.8623
59	E	A	-2.9589
60	E	A	-3.1081
61	D	A	-2.3429
62	L	A	-0.6202
63	L	A	0.0000
64	N	A	-0.3305
65	L	A	0.8133	mutated: AA65L
66	P	A	0.4130	mutated: KA66P
67	V	A	0.6998	mutated: GA67V
68	E	A	-0.4845
69	R	A	-2.1455	mutated: TA69R
70	F	A	-1.4358
71	E	A	-2.6147
72	V	A	0.0000
73	A	A	-1.7801
74	L	A	0.0000
75	S	A	-1.8467
76	N	A	-2.6908
77	K	A	-3.2197
78	G	A	-2.3716
79	E	A	-2.5121
80	Y	A	0.0000
81	S	A	-1.4841
82	F	A	0.0000
83	Y	A	-0.3276
84	C	A	0.0000
85	S	A	-1.1681
86	P	A	-0.9009
87	H	A	-0.6049
88	Q	A	-0.9712
89	G	A	-0.9381
90	A	A	-0.5223
91	G	A	-0.5156
92	M	A	0.0000
93	V	A	0.0873
94	G	A	0.0000
95	K	A	-1.6706
96	V	A	0.0000
97	T	A	-2.0481
98	V	A	0.0000
99	N	A	-2.3827