Project name: SH3_S82V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA82V
Energy difference between WT (input) and mutated protein (by FoldX)	0.564196 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4841
• Maximal score value: 1.3112
• Average score: -0.8076
• Total score value: -48.4588

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	0.5264
82	V	A	1.3112	mutated: SA82V
83	H	A	0.1791
84	M	A	0.8595
85	T	A	0.0000
86	F	A	-0.0924
87	V	A	-0.6181
88	A	A	0.0000
89	L	A	-0.3132
90	Y	A	-0.7370
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1546
97	E	A	-2.3532
98	T	A	-1.2427
99	D	A	-1.3251
100	L	A	0.0000
101	S	A	-1.9041
102	F	A	0.0000
103	K	A	-3.4841
104	K	A	-2.8621
105	G	A	-1.9629
106	E	A	0.0000
107	R	A	-2.0611
108	L	A	0.0000
109	Q	A	0.1124
110	I	A	0.6847
111	V	A	1.2693
112	N	A	-0.4028
113	N	A	-1.8092
114	T	A	-1.7294
115	E	A	-2.9343
116	G	A	-2.6073
117	D	A	-2.6850
118	W	A	-1.3424
119	W	A	-0.6959
120	L	A	0.4143
121	A	A	0.0000
122	H	A	-0.3641
123	S	A	0.0000
124	L	A	-0.2683
125	T	A	-0.7802
126	T	A	-0.8778
127	G	A	-0.8166
128	Q	A	-1.4115
129	T	A	-0.4894
130	G	A	0.0000
131	Y	A	0.2162
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2863
135	N	A	-1.2485
136	Y	A	-0.2043
137	V	A	0.0000
138	A	A	-0.0221
139	P	A	-0.1457
140	S	A	-0.1767