Project name: SH3_S134Q

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134Q
Energy difference between WT (input) and mutated protein (by FoldX)	0.722516 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2458
• Average score: -0.9241
• Total score value: -55.4456

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0969
87	V	A	-0.6191
88	A	A	0.0000
89	L	A	-0.3117
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3267
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9613
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.3891
111	V	A	1.2458
112	N	A	-0.4289
113	N	A	-1.8857
114	T	A	-1.7393
115	E	A	-2.9956
116	G	A	-2.7064
117	D	A	-2.8297
118	W	A	-1.4981
119	W	A	-0.8494
120	L	A	0.3373
121	A	A	0.0000
122	H	A	-0.3863
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4944
130	G	A	0.0000
131	Y	A	0.1516
132	I	A	0.0000
133	P	A	0.0000
134	Q	A	-1.7306	mutated: SA134Q
135	N	A	-1.4654
136	Y	A	-0.3445
137	V	A	0.0000
138	A	A	-0.0868
139	P	A	-0.1471
140	S	A	-0.1735