Project name: SH3_Y136M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136M
Energy difference between WT (input) and mutated protein (by FoldX)	0.240119 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4596
• Maximal score value: 1.2498
• Average score: -0.9097
• Total score value: -54.5794

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1212
87	V	A	-0.6338
88	A	A	0.0000
89	L	A	-0.3180
90	Y	A	-0.6839
91	D	A	-2.8295
92	Y	A	-2.1080
93	E	A	-2.8809
94	S	A	0.0000
95	R	A	-2.7835
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3259
100	L	A	0.0000
101	S	A	-1.9030
102	F	A	0.0000
103	K	A	-3.4596
104	K	A	-2.8431
105	G	A	-1.9452
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6117
117	D	A	-2.6913
118	W	A	-1.3678
119	W	A	-0.7039
120	L	A	0.4015
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2143
132	I	A	0.0000
133	P	A	-0.6102
134	S	A	-1.3477
135	N	A	-1.3198
136	M	A	-0.3390	mutated: YA136M
137	V	A	0.0000
138	A	A	-0.0533
139	P	A	-0.1505
140	S	A	-0.1759