Project name: SH3_W119I

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119I
Energy difference between WT (input) and mutated protein (by FoldX)	1.30157 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2234
• Average score: -0.8898
• Total score value: -53.3905

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4487
82	S	A	-0.6805
83	H	A	-0.7912
84	M	A	0.2892
85	T	A	0.0000
86	F	A	-0.0117
87	V	A	-0.5785
88	A	A	0.0000
89	L	A	-0.3017
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3433
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9513
106	E	A	0.0000
107	R	A	-2.0440
108	L	A	0.0000
109	Q	A	-0.2174
110	I	A	0.4290
111	V	A	1.2234
112	N	A	-0.4701
113	N	A	-1.8823
114	T	A	-1.7674
115	E	A	-2.9831
116	G	A	-2.6515
117	D	A	-2.7347
118	W	A	-1.4397
119	I	A	0.0000	mutated: WA119I
120	L	A	0.3178
121	A	A	0.0000
122	H	A	-0.3985
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4930
130	G	A	0.0000
131	Y	A	0.1573
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3615
135	N	A	-1.2812
136	Y	A	-0.2036
137	V	A	0.0000
138	A	A	0.0038
139	P	A	-0.1090
140	S	A	-0.1434