Project name: SH3_W119H

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119H
Energy difference between WT (input) and mutated protein (by FoldX)	3.51936 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1954
• Average score: -0.9144
• Total score value: -54.8648

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4494
82	S	A	-0.6812
83	H	A	-0.7912
84	M	A	0.2880
85	T	A	0.0000
86	F	A	-0.0143
87	V	A	-0.5792
88	A	A	0.0000
89	L	A	-0.3019
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3578
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9515
106	E	A	0.0000
107	R	A	-2.0450
108	L	A	0.0000
109	Q	A	-0.2205
110	I	A	0.3957
111	V	A	1.1954
112	N	A	-0.5112
113	N	A	-1.9298
114	T	A	-1.7920
115	E	A	-3.0119
116	G	A	-2.6742
117	D	A	-2.7584
118	W	A	-1.4970
119	H	A	-1.0064	mutated: WA119H
120	L	A	0.2554
121	A	A	0.0000
122	H	A	-0.4134
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4936
130	G	A	0.0000
131	Y	A	0.1157
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3795
135	N	A	-1.2859
136	Y	A	-0.1980
137	V	A	0.0000
138	A	A	0.0061
139	P	A	-0.1102
140	S	A	-0.1439