Project name: SH3_L120S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120S
Energy difference between WT (input) and mutated protein (by FoldX)	3.78564 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.034
• Average score: -0.9424
• Total score value: -56.5447

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4531
82	S	A	-0.6854
83	H	A	-0.7932
84	M	A	0.2632
85	T	A	0.0000
86	F	A	-0.1090
87	V	A	-0.6247
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1642
97	E	A	-2.3628
98	T	A	-1.3061
99	D	A	-1.4163
100	L	A	0.0000
101	S	A	-1.9161
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0762
108	L	A	0.0000
109	Q	A	-0.3374
110	I	A	0.2764
111	V	A	1.0340
112	N	A	-0.7487
113	N	A	-1.9985
114	T	A	-1.8338
115	E	A	-3.0163
116	G	A	-2.6359
117	D	A	-2.7084
118	W	A	-1.4940
119	W	A	-0.9587
120	S	A	-0.0374	mutated: LA120S
121	A	A	0.0000
122	H	A	-0.4992
123	S	A	0.0000
124	L	A	-0.2853
125	T	A	-0.7811
126	T	A	-0.8791
127	G	A	-0.8187
128	Q	A	-1.4146
129	T	A	-0.5825
130	G	A	0.0000
131	Y	A	-0.0463
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3452
135	N	A	-1.2527
136	Y	A	-0.2070
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1524
140	S	A	-0.1759