Project name: SH3_Q128W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA128W
Energy difference between WT (input) and mutated protein (by FoldX)	0.119308 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4735
• Maximal score value: 1.2498
• Average score: -0.7669
• Total score value: -46.0132

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8456
92	Y	A	-2.0924
93	E	A	-2.8650
94	S	A	0.0000
95	R	A	-2.7776
96	T	A	-2.1494
97	E	A	-2.3526
98	T	A	-1.2369
99	D	A	-1.0686
100	L	A	0.0000
101	S	A	-1.4782
102	F	A	0.0000
103	K	A	-3.4735
104	K	A	-2.8616
105	G	A	-1.9620
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	0.2787
123	S	A	0.0000
124	L	A	0.1504
125	T	A	-0.4001
126	T	A	-0.0935
127	G	A	0.3248
128	W	A	0.9695	mutated: QA128W
129	T	A	0.6775
130	G	A	0.0000
131	Y	A	0.2253
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759