Project name: Aggregation site prediction [mutate: QA62V]

Chain sequence(s)	A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA62V
Energy difference between WT (input) and mutated protein (by FoldX)	-0.0568365 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.8963
• Maximal score value: 3.1839
• Average score: -0.817
• Total score value: -114.3855

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.8597
2	D	A	0.1272
3	V	A	1.8610
4	F	A	2.0361
5	M	A	0.9291
6	K	A	-0.7687
7	G	A	-0.5657
8	L	A	-0.3201
9	S	A	-1.8655
10	K	A	-2.7839
11	A	A	-1.7065
12	K	A	-2.0158
13	E	A	-2.1933
14	G	A	-0.6952
15	V	A	0.8972
16	V	A	0.8277
17	A	A	-0.5669
18	A	A	-0.8593
19	A	A	-1.1190
20	E	A	-2.9551
21	K	A	-3.2030
22	T	A	-2.1194
23	K	A	-3.2931
24	Q	A	-3.1713
25	G	A	-1.8543
26	V	A	-0.2915
27	A	A	-1.4145
28	E	A	-2.5934
29	A	A	-1.4566
30	A	A	-1.5584
31	G	A	-2.6849
32	K	A	-3.2644
33	T	A	-2.3212
34	K	A	-2.9613
35	E	A	-2.1704
36	G	A	-0.7280
37	V	A	1.3091
38	L	A	1.5612
39	Y	A	1.7507
40	V	A	0.5275
41	G	A	-0.5343
42	S	A	-1.0990
43	K	A	-2.1559
44	T	A	-1.8897
45	K	A	-2.6721
46	E	A	-2.5875
47	G	A	-1.5659
48	V	A	-0.2004
49	V	A	0.6109
50	H	A	-0.1647
51	G	A	0.6857
52	V	A	2.3565
53	A	A	0.8775
54	T	A	0.3842
55	V	A	0.8300
56	A	A	-0.7777
57	E	A	-2.5167
58	K	A	-2.5573
59	T	A	-1.2933
60	K	A	-2.6037
61	E	A	-2.4487
62	V	A	0.3453	mutated: QA62V
63	V	A	1.3542
64	T	A	-0.2992
65	N	A	-0.2595
66	V	A	1.8614
67	G	A	1.2509
68	G	A	0.8481
69	A	A	1.7624
70	V	A	3.1839
71	V	A	3.0837
72	T	A	1.9988
73	G	A	2.1496
74	V	A	2.9648
75	T	A	1.4677
76	A	A	0.9221
77	V	A	1.3337
78	A	A	0.3305
79	Q	A	-1.1649
80	K	A	-1.5455
81	T	A	-0.6777
82	V	A	0.0339
83	E	A	-1.7228
84	G	A	-0.9781
85	A	A	0.0959
86	G	A	-0.1821
87	S	A	0.3215
88	I	A	1.4869
89	A	A	0.9232
90	A	A	1.2356
91	A	A	1.2745
92	T	A	1.0202
93	G	A	0.9125
94	F	A	1.8629
95	V	A	1.1823
96	K	A	-1.7131
97	K	A	-2.7409
98	D	A	-3.0747
99	Q	A	-2.2090
100	L	A	-0.6707
101	G	A	-1.6529
102	K	A	-2.9237
103	N	A	-3.5657
104	E	A	-3.8963
105	E	A	-3.7178
106	G	A	-2.2185
107	A	A	-1.7389
108	P	A	-1.8954
109	Q	A	-2.6191
110	E	A	-2.6188
111	G	A	-0.9668
112	I	A	1.0976
113	L	A	0.2800
114	E	A	-1.7082
115	D	A	-1.5939
116	M	A	-0.0399
117	P	A	-0.4135
118	V	A	-0.5385
119	D	A	-2.4275
120	P	A	-2.4663
121	D	A	-3.0245
122	N	A	-2.6329
123	E	A	-2.8084
124	A	A	-1.3449
125	Y	A	-0.3108
126	E	A	-1.9827
127	M	A	-0.8110
128	P	A	-1.2829
129	S	A	-1.6616
130	E	A	-2.7938
131	E	A	-2.7542
132	G	A	-2.0398
133	Y	A	-0.6750
134	Q	A	-1.8112
135	D	A	-2.2074
136	Y	A	-1.0889
137	E	A	-2.3465
138	P	A	-1.8129
139	E	A	-2.0778
140	A	A	-1.1262