Project name: SH3_Y136N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136N
Energy difference between WT (input) and mutated protein (by FoldX)	2.44704 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4272
• Maximal score value: 1.2498
• Average score: -0.9204
• Total score value: -55.2262

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1529
87	V	A	-0.6680
88	A	A	0.0000
89	L	A	-0.3714
90	Y	A	-0.6796
91	D	A	-2.8130
92	Y	A	-2.0805
93	E	A	-2.8535
94	S	A	0.0000
95	R	A	-2.7779
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3200
100	L	A	0.0000
101	S	A	-1.8851
102	F	A	0.0000
103	K	A	-3.4272
104	K	A	-2.8443
105	G	A	-1.9318
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9362
116	G	A	-2.6120
117	D	A	-2.6919
118	W	A	-1.3991
119	W	A	-0.7044
120	L	A	0.4012
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2137
132	I	A	0.0000
133	P	A	-0.6962
134	S	A	-1.4441
135	N	A	-1.4544
136	N	A	-0.6055	mutated: YA136N
137	V	A	0.0000
138	A	A	-0.1135
139	P	A	-0.1505
140	S	A	-0.1759