Project name: e4dc31a1a3466bc

Chain sequence(s)	A: EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.2291
• Maximal score value: 1.2691
• Average score: -1.0209
• Total score value: -69.4225

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
108	E	A	-2.9396
109	K	A	-3.1544
110	P	A	-2.4430
111	R	A	-2.6385
112	G	A	0.0000
113	F	A	-0.9461
114	A	A	-0.9241
115	R	A	-1.4389
116	G	A	-1.0217
117	L	A	-1.4061
118	E	A	-2.8749
119	P	A	-2.4310
120	E	A	-2.5077
121	R	A	-2.0793
122	I	A	0.0000
123	I	A	1.2131
124	G	A	0.7928
125	A	A	0.3827
126	T	A	-0.8645
127	D	A	-2.2433
128	S	A	-1.6082
129	S	A	-1.2370
130	G	A	-1.6828
131	E	A	-2.1765
132	L	A	-0.9766
133	M	A	-0.5651
134	F	A	0.0000
135	L	A	0.8281
136	M	A	0.0000
137	K	A	-2.0097
138	W	A	0.0000
139	K	A	-3.1853
140	N	A	-2.7542
141	S	A	-2.7063
142	D	A	-3.2291
143	E	A	-3.1138
144	A	A	-1.7557
145	D	A	-0.7388
146	L	A	0.2916
147	V	A	0.0000
148	P	A	-0.7914
149	A	A	0.0000
150	K	A	-2.2127
151	E	A	-1.5854
152	A	A	0.0000
153	N	A	-1.5127
154	V	A	-0.3515
155	K	A	-1.8821
156	C	A	0.0000
157	P	A	-0.7077
158	Q	A	-0.9399
159	V	A	0.0000
160	V	A	0.0000
161	I	A	0.5086
162	S	A	-0.9232
163	F	A	-0.4381
164	Y	A	-0.4906
165	E	A	-1.9685
166	E	A	-2.6730
167	R	A	-2.3338
168	L	A	-0.0885
169	T	A	0.3411
170	W	A	1.2691
171	H	A	-0.2559
172	S	A	0.2440
173	Y	A	1.1797
174	P	A	0.3662
175	S	A	-0.0323