Project name: SH3_S134E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134E
Energy difference between WT (input) and mutated protein (by FoldX)	1.00791 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4966
• Maximal score value: 1.2464
• Average score: -0.9361
• Total score value: -56.1655

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0969
87	V	A	-0.6253
88	A	A	0.0000
89	L	A	-0.3362
90	Y	A	-0.7872
91	D	A	-2.8775
92	Y	A	-2.1180
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3264
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4966
104	K	A	-2.8828
105	G	A	-1.9705
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.3737
111	V	A	1.2464
112	N	A	-0.4279
113	N	A	-1.9051
114	T	A	-1.7387
115	E	A	-3.0124
116	G	A	-2.7370
117	D	A	-2.8762
118	W	A	-1.5443
119	W	A	-0.8871
120	L	A	0.3209
121	A	A	0.0000
122	H	A	-0.3859
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4944
130	G	A	0.0000
131	Y	A	0.1329
132	I	A	0.0000
133	P	A	0.0000
134	E	A	-1.8796	mutated: SA134E
135	N	A	-1.5441
136	Y	A	-0.4070
137	V	A	0.0000
138	A	A	-0.1101
139	P	A	-0.1471
140	S	A	-0.1735