Project name: FcG1dyn

Status: done

submitted: 2019-04-04 01:06:14, status changed: 2019-04-04 03:36:04
Settings
Chain sequence(s) A: GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Distance of aggregation 5 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-2.246
Maximal score value
2.0171
Average score
-0.3155
Total score value
-65.9379

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
236 G A -0.4771
237 G A -0.1642
238 P A -0.1429
239 S A -0.0784
240 V A 0.5237
241 F A 2.0171
242 L A 0.9534
243 F A 1.9690
244 P A 0.2508
245 P A -0.5545
246 K A -1.7532
247 P A -0.7939
248 K A -1.3806
249 D A -1.1136
250 T A 0.0000
251 L A 0.0000
252 M A 0.3365
253 I A 1.6013
254 S A -0.1334
255 R A -1.4090
256 T A -0.3016
257 P A 0.0000
258 E A -1.8309
259 V A 0.0000
260 T A -0.0134
261 C A 0.0000
262 V A 0.2589
263 V A 0.0000
264 V A 0.1678
265 D A 0.0000
266 V A 1.2987
267 S A -0.3640
268 H A -1.3540
269 E A -2.0628
270 D A -0.6346
271 P A -0.5433
272 E A -1.2847
273 V A -0.3707
274 K A -1.6663
275 F A 0.0000
276 N A -0.4399
277 W A 0.0000
278 Y A 0.3133
279 V A -0.0530
280 D A -1.8334
281 G A -0.4632
282 V A 1.3625
283 E A -1.2361
284 V A 0.0761
285 H A -0.9760
286 N A -0.4694
287 A A -0.3626
288 K A -1.6982
289 T A -0.6189
290 K A -1.7522
291 P A -0.8705
292 R A -2.0003
293 E A -2.1293
294 E A -0.8329
295 Q A -1.0372
296 Y A 0.8682
297 N A -1.1896
298 S A -0.5920
299 T A -0.0100
300 Y A -0.0724
301 R A -0.4584
302 V A 0.0000
303 V A 0.2697
304 S A 0.0000
305 V A 0.6868
306 L A 0.0000
307 T A -0.1966
308 V A 0.6353
309 L A 1.5024
310 H A 0.0000
311 Q A -1.2671
312 D A -0.6903
313 W A 0.1433
314 L A -0.0815
315 N A -1.3243
316 G A -0.6333
317 K A -1.4334
318 E A -1.0290
319 Y A -0.1464
320 K A -0.9116
321 C A 0.0000
322 K A -1.3618
323 V A 0.0000
324 S A -0.1188
325 N A 0.0000
326 K A -0.5146
327 A A 0.2070
328 L A 1.4392
329 P A 0.0403
330 A A -0.0745
331 P A -0.2230
332 I A -0.1809
333 E A -1.9948
334 K A -0.8668
335 T A -0.2310
336 I A 0.3005
337 S A -0.3017
338 K A -0.5154
339 A A -0.3683
340 K A -1.7364
341 G A -0.8093
342 Q A -1.2855
343 P A -0.4971
344 R A -0.3416
345 E A -1.1296
346 P A -0.3089
347 Q A -0.5197
348 V A 0.0000
349 Y A 1.2019
350 T A 0.3239
351 L A 0.5965
352 P A -0.1762
353 P A -0.3229
354 S A -0.5798
355 R A -2.0912
356 E A -2.2460
357 E A -0.7634
358 M A 0.9422
359 T A -0.1880
360 K A -1.9552
361 N A -1.6451
362 Q A -0.5560
363 V A 0.0000
364 S A 0.0000
365 L A 0.0000
366 T A 0.0000
367 C A 0.0000
368 L A 0.3206
369 V A 0.0000
370 K A -0.5331
371 G A 0.0080
372 F A 0.7722
373 Y A 1.3498
374 P A -0.0701
375 S A -0.3397
376 D A -0.4206
377 I A 0.0000
378 A A 0.0000
379 V A 0.0758
380 E A -0.6244
381 W A 0.0000
382 E A -1.4982
383 S A 0.0000
384 N A -1.3613
385 G A -0.9251
386 Q A -1.3309
387 P A -0.6982
388 E A -0.5240
389 N A -1.1109
390 N A -0.5499
391 Y A 0.9271
392 K A -1.2260
393 T A -0.3239
394 T A -0.0979
395 P A -0.3077
396 P A -0.0042
397 V A 1.6629
398 L A 1.7315
399 D A -0.5820
400 S A -0.6906
401 D A -1.8985
402 G A -0.7111
403 S A 0.0216
404 F A 0.8524
405 F A 0.6684
406 L A 0.0000
407 Y A 0.3290
408 S A 0.0000
409 K A -0.5696
410 L A 0.0000
411 T A -0.0207
412 V A 0.0000
413 D A -0.8611
414 K A -1.2269
415 S A -0.4282
416 R A -0.7273
417 W A 0.0291
418 Q A -1.3749
419 Q A -1.4532
420 G A -0.5314
421 N A 0.1150
422 V A 1.7362
423 F A 0.0000
424 S A -0.0428
425 C A 0.0000
426 S A -0.1811
427 V A 0.0000
428 M A 0.0000
429 H A 0.0000
430 E A -0.2221
431 A A 0.0517
432 L A 0.0110
433 H A -1.1701
434 N A -1.3807
435 H A -0.5114
436 Y A 1.0714
437 T A 0.0000
438 Q A -1.1471
439 K A -0.8043
440 S A -0.2231
441 L A 0.1384
442 S A -0.1482
443 L A 0.0821
444 S A -0.1863

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.3155 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015