Project name: e60f27ad7922a5d

Status: done

submitted: 2019-01-30 14:09:09, status changed: 2019-01-30 14:12:47
Settings
Chain sequence(s) A: MSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.0864
Maximal score value
1.8869
Average score
-0.6489
Total score value
-62.9462

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 M A 0.8485
3 S A 0.2554
4 G A 0.1483
5 A A -0.3626
6 P A -0.9089
7 S A -0.9715
8 A A -0.7519
9 T A -0.8997
10 Q A -0.7587
11 P A -0.1976
12 A A -0.3315
13 T A -0.4284
14 A A -0.9006
15 E A -1.9117
16 T A -0.7544
17 Q A -1.3352
18 H A -1.7352
19 I A 0.2179
20 A A -0.7294
21 D A -2.3726
22 Q A -1.4807
23 V A -0.1963
24 R A -1.3770
25 S A -2.2494
26 Q A -1.8778
27 L A -1.5486
28 E A 0.0000
29 E A -3.7114
30 K A -2.9063
31 Y A -1.5039
32 N A -2.8647
33 K A -3.3359
34 K A -2.7122
35 F A -0.4381
36 P A -0.0163
37 V A 1.2573
38 F A 0.0196
39 K A -0.9761
40 A A -0.0038
41 V A 1.2450
42 S A 0.1220
43 F A -0.3774
44 K A -2.1091
45 S A -1.3081
46 Q A -0.9119
47 V A 1.0979
48 V A 1.7995
49 A A 0.9620
50 G A 0.3069
51 T A 0.2061
52 N A 0.3665
53 Y A 1.3885
54 F A 1.4494
55 I A 1.5052
56 K A -0.0191
57 V A 0.1454
58 H A -1.4197
59 V A -0.2307
60 G A -1.4997
61 D A -3.1357
62 E A -4.0864
63 D A -3.6851
64 F A 0.0000
65 V A -0.3710
66 H A 0.0000
67 L A 1.3944
68 R A 1.1715
69 V A 1.4179
70 F A 0.8726
71 Q A 0.0750
72 S A -0.0857
73 L A 0.1159
74 P A -0.9604
75 H A -2.0438
76 E A -2.7580
77 N A -2.0373
78 K A -2.2546
79 S A -0.7108
80 L A 0.8553
81 T A 1.0786
82 L A 1.8869
83 S A 0.9206
84 N A 0.4807
85 Y A 1.2032
86 Q A -0.4279
87 T A -0.7505
88 N A -2.1286
89 K A -2.6727
90 A A -3.0471
91 K A -3.5280
92 H A -2.4828
93 D A -2.2554
94 E A -1.9639
95 L A 0.4997
96 T A 0.6249
97 Y A 1.5951
98 F A 1.3299

 

Laboratory of Theory of Biopolymers 2015