Project name: SH3_D99N

Status: done

submitted: 2019-03-14 15:19:36, status changed: 2019-03-14 16:33:21
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA99N
Energy difference between WT (input) and mutated protein (by FoldX) 0.749998 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4831
Maximal score value
1.2492
Average score
-0.8892
Total score value
-53.3529

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3121
90 Y A -0.7357
91 D A -2.8511
92 Y A -2.0912
93 E A -2.8659
94 S A 0.0000
95 R A -2.7650
96 T A -2.1248
97 E A -2.3254
98 T A -1.1958
99 N A -1.2273 mutated: DA99N
100 L A 0.0000
101 S A -1.8811
102 F A 0.0000
103 K A -3.4831
104 K A -2.8610
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4366
111 V A 1.2492
112 N A -0.4207
113 N A -1.8148
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6850
118 W A -1.3322
119 W A -0.6885
120 L A 0.4177
121 A A 0.0000
122 H A -0.3848
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8781
127 G A -0.8169
128 Q A -1.4021
129 T A -0.4790
130 G A 0.0000
131 Y A 0.2557
132 I A 0.0000
133 P A 0.0000
134 S A -1.2863
135 N A -1.2485
136 Y A -0.2033
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015