Project name: SH3_W119V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119V
Energy difference between WT (input) and mutated protein (by FoldX)	2.03297 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2337
• Average score: -0.8837
• Total score value: -53.0196

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4508
82	S	A	-0.6824
83	H	A	-0.7912
84	M	A	0.2884
85	T	A	0.0000
86	F	A	0.0417
87	V	A	-0.5174
88	A	A	0.0000
89	L	A	-0.2422
90	Y	A	-0.7060
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1627
97	E	A	-2.3613
98	T	A	-1.2577
99	D	A	-1.3751
100	L	A	0.0000
101	S	A	-1.9143
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8378
105	G	A	-1.9290
106	E	A	0.0000
107	R	A	-2.0233
108	L	A	0.0000
109	Q	A	-0.2147
110	I	A	0.4409
111	V	A	1.2337
112	N	A	-0.4428
113	N	A	-1.8766
114	T	A	-1.7569
115	E	A	-2.9816
116	G	A	-2.6573
117	D	A	-2.7587
118	W	A	-1.4799
119	V	A	0.0000	mutated: WA119V
120	L	A	0.3176
121	A	A	0.0000
122	H	A	-0.4030
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5041
130	G	A	0.0000
131	Y	A	0.0866
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3351
135	N	A	-1.2326
136	Y	A	-0.1214
137	V	A	-0.0441
138	A	A	0.0919
139	P	A	-0.0682
140	S	A	-0.1182