Project name: SH3_Y136G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136G
Energy difference between WT (input) and mutated protein (by FoldX)	3.20893 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4046
• Maximal score value: 1.2498
• Average score: -0.9005
• Total score value: -54.0305

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1384
87	V	A	-0.6425
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.5851
91	D	A	-2.7485
92	Y	A	-2.0080
93	E	A	-2.8336
94	S	A	0.0000
95	R	A	-2.7746
96	T	A	-2.1557
97	E	A	-2.3541
98	T	A	-1.2439
99	D	A	-1.3224
100	L	A	0.0000
101	S	A	-1.8728
102	F	A	0.0000
103	K	A	-3.4046
104	K	A	-2.7989
105	G	A	-1.9233
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4203
113	N	A	-1.8146
114	T	A	-1.7331
115	E	A	-2.9369
116	G	A	-2.6143
117	D	A	-2.6967
118	W	A	-1.3931
119	W	A	-0.7093
120	L	A	0.3981
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4124
129	T	A	-0.4959
130	G	A	0.0000
131	Y	A	0.2080
132	I	A	0.0000
133	P	A	-0.6641
134	S	A	-1.4081
135	N	A	-1.3889
136	G	A	0.0000	mutated: YA136G
137	V	A	0.0000
138	A	A	-0.0859
139	P	A	-0.1505
140	S	A	-0.1759