Project name: 2JXZ

Chain sequence(s)	A: CGNLSTCMLGTLTQDFHKFHTFPQTNTGVGTP
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -0.908
• Maximal score value: 2.0268
• Average score: 0.3368
• Total score value: 10.7781

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	C	A	0.6873
2	G	A	-0.3945
3	N	A	-0.4716
4	L	A	1.3049
5	S	A	0.8568
6	T	A	0.9298
7	C	A	1.3352
8	M	A	1.7111
9	L	A	2.0268
10	G	A	0.9629
11	T	A	0.4857
12	L	A	1.0203
13	T	A	0.3903
14	Q	A	-0.6507
15	D	A	-0.1059
16	F	A	0.8293
17	H	A	-0.4031
18	K	A	0.1147
19	F	A	1.0546
20	H	A	-0.1076
21	T	A	0.1887
22	F	A	0.2986
23	P	A	-0.0307
24	Q	A	-0.4501
25	T	A	0.0000
26	N	A	-0.9080
27	T	A	-0.5536
28	G	A	0.0684
29	V	A	0.7352
30	G	A	0.1065
31	T	A	-0.0896
32	P	A	-0.1636