Project name: SH3_L124M

Status: done

submitted: 2019-03-14 15:33:54, status changed: 2019-03-14 18:00:00
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues LA124M
Energy difference between WT (input) and mutated protein (by FoldX) 0.612001 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4666
Maximal score value
1.2175
Average score
-0.9132
Total score value
-54.7928

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4603
82 S A -0.6950
83 H A -0.8001
84 M A 0.2508
85 T A 0.0000
86 F A -0.0800
87 V A -0.5764
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2408
99 D A -1.3222
100 L A 0.0000
101 S A -1.9031
102 F A 0.0000
103 K A -3.4666
104 K A -2.8414
105 G A -1.9237
106 E A 0.0000
107 R A -2.0526
108 L A 0.0000
109 Q A -0.3907
110 I A 0.4025
111 V A 1.2175
112 N A -0.4343
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.7021
120 L A 0.3851
121 A A 0.0000
122 H A -0.5291
123 S A 0.0000
124 M A -0.6255 mutated: LA124M
125 T A -0.9167
126 T A -0.9679
127 G A -0.9361
128 Q A -1.4841
129 T A -0.5652
130 G A 0.0000
131 Y A 0.2140
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1417
140 S A -0.1512

 

Laboratory of Theory of Biopolymers 2015