Project name: SH3_Y136R

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136R
Energy difference between WT (input) and mutated protein (by FoldX)	1.95438 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5106
• Maximal score value: 1.2498
• Average score: -0.947
• Total score value: -56.8196

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1908
87	V	A	-0.7480
88	A	A	0.0000
89	L	A	-0.6097
90	Y	A	-1.0328
91	D	A	-3.0283
92	Y	A	-2.2851
93	E	A	-2.9005
94	S	A	0.0000
95	R	A	-2.7876
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3272
100	L	A	0.0000
101	S	A	-1.9159
102	F	A	0.0000
103	K	A	-3.5106
104	K	A	-3.0066
105	G	A	-1.9742
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6845
118	W	A	-1.4248
119	W	A	-0.6979
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.5441
135	N	A	-1.6408
136	R	A	-1.0257	mutated: YA136R
137	V	A	0.0000
138	A	A	-0.1855
139	P	A	-0.1505
140	S	A	-0.1759