Project name: SH3_N112Y

Status: done

submitted: 2019-03-14 15:26:43, status changed: 2019-03-14 17:17:14
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA112Y
Energy difference between WT (input) and mutated protein (by FoldX) 0.414685 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.3625
Average score
-0.8212
Total score value
-49.2694

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.5469
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1493
97 E A -2.3478
98 T A -1.2387
99 D A -1.3155
100 L A 0.0000
101 S A -1.8975
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2479
110 I A 0.5728
111 V A 1.3625
112 Y A 1.0518 mutated: NA112Y
113 N A -1.0949
114 T A -1.2787
115 E A -2.6222
116 G A -2.4217
117 D A -2.6818
118 W A -1.1009
119 W A -0.2967
120 L A 0.7990
121 A A 0.0000
122 H A -0.3706
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5967
130 G A 0.0000
131 Y A 0.3946
132 I A 0.0000
133 P A 0.0000
134 S A -1.2894
135 N A -1.2490
136 Y A -0.2043
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015