Project name: SH3_W119P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119P
Energy difference between WT (input) and mutated protein (by FoldX)	4.10857 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2413
• Average score: -0.8818
• Total score value: -52.9078

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4490
82	S	A	-0.6807
83	H	A	-0.7912
84	M	A	0.2906
85	T	A	0.0000
86	F	A	0.0462
87	V	A	-0.5155
88	A	A	0.0000
89	L	A	-0.2404
90	Y	A	-0.7050
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1625
97	E	A	-2.3611
98	T	A	-1.2576
99	D	A	-1.3742
100	L	A	0.0000
101	S	A	-1.9140
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8371
105	G	A	-1.9283
106	E	A	0.0000
107	R	A	-2.0211
108	L	A	0.0000
109	Q	A	-0.2077
110	I	A	0.4565
111	V	A	1.2413
112	N	A	-0.4363
113	N	A	-1.8716
114	T	A	-1.7560
115	E	A	-2.9803
116	G	A	-2.6556
117	D	A	-2.7562
118	W	A	-1.4753
119	P	A	0.0000	mutated: WA119P
120	L	A	0.3213
121	A	A	0.0000
122	H	A	-0.3995
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5027
130	G	A	0.0000
131	Y	A	0.0907
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3294
135	N	A	-1.2296
136	Y	A	-0.1178
137	V	A	-0.0365
138	A	A	0.0948
139	P	A	-0.0655
140	S	A	-0.1175