Project name: SH3_V111P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	VA111P
Energy difference between WT (input) and mutated protein (by FoldX)	4.09616 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.2708
• Average score: -1.0045
• Total score value: -60.2705

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.6874
82	S	A	-0.6797
83	H	A	-0.7932
84	M	A	0.2708
85	T	A	0.0000
86	F	A	-0.0987
87	V	A	-0.6247
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1605
97	E	A	-2.3591
98	T	A	-1.2472
99	D	A	-1.3368
100	L	A	0.0000
101	S	A	-1.9118
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0727
108	L	A	0.0000
109	Q	A	-0.7573
110	I	A	-0.4250
111	P	A	-0.6097	mutated: VA111P
112	N	A	-1.1987
113	N	A	-2.1719
114	T	A	-1.9076
115	E	A	-2.9021
116	G	A	-2.5944
117	D	A	-2.6917
118	W	A	-1.3239
119	W	A	-1.0151
120	L	A	-0.1359
121	A	A	0.0000
122	H	A	-0.8314
123	S	A	0.0000
124	L	A	-0.2885
125	T	A	-0.7828
126	T	A	-0.8809
127	G	A	-0.8215
128	Q	A	-1.4179
129	T	A	-0.7417
130	G	A	0.0000
131	Y	A	-0.0144
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2799
135	N	A	-1.2490
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1470
140	S	A	-0.1759