Project name: SH3_Q109S

Status: done

submitted: 2019-03-14 15:24:21, status changed: 2019-03-14 17:00:48
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues QA109S
Energy difference between WT (input) and mutated protein (by FoldX) 1.16973 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.3969
Average score
-0.8443
Total score value
-50.656

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.3776
82 S A -0.5843
83 H A -0.7207
84 M A 0.3932
85 T A 0.0000
86 F A 0.0573
87 V A -0.5388
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2410
99 D A -1.3224
100 L A 0.0000
101 S A -1.9031
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -1.8623
108 L A 0.0000
109 S A 0.4075 mutated: QA109S
110 I A 0.7193
111 V A 1.3969
112 N A -0.3563
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.7098
120 L A 0.4697
121 A A 0.0000
122 H A -0.1958
123 S A 0.0000
124 L A 0.1234
125 T A -0.6488
126 T A -0.7996
127 G A -0.7325
128 Q A -1.3833
129 T A -0.4268
130 G A 0.0000
131 Y A 0.2040
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.0836
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015