Project name: SH3_W119C

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119C
Energy difference between WT (input) and mutated protein (by FoldX)	2.9531 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2346
• Average score: -0.883
• Total score value: -52.9781

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2890
85	T	A	0.0000
86	F	A	0.0427
87	V	A	-0.5171
88	A	A	0.0000
89	L	A	-0.2419
90	Y	A	-0.7058
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1625
97	E	A	-2.3611
98	T	A	-1.2576
99	D	A	-1.3747
100	L	A	0.0000
101	S	A	-1.9140
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8377
105	G	A	-1.9289
106	E	A	0.0000
107	R	A	-2.0228
108	L	A	0.0000
109	Q	A	-0.2134
110	I	A	0.4448
111	V	A	1.2346
112	N	A	-0.4427
113	N	A	-1.8753
114	T	A	-1.7574
115	E	A	-2.9811
116	G	A	-2.6558
117	D	A	-2.7562
118	W	A	-1.4777
119	C	A	0.0000	mutated: WA119C
120	L	A	0.3171
121	A	A	0.0000
122	H	A	-0.4025
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5039
130	G	A	0.0000
131	Y	A	0.0887
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3272
135	N	A	-1.2287
136	Y	A	-0.1186
137	V	A	-0.0407
138	A	A	0.0935
139	P	A	-0.0676
140	S	A	-0.1181