Project name: 1BK2

Chain sequence(s)	A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Distance of aggregation	5 Å
Dynamic mode	No

• Minimal score value: -2.3116
• Maximal score value: 1.6089
• Average score: -0.5336
• Total score value: -30.414

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
6	K	A	-1.7649
7	E	A	-0.5159
8	L	A	0.7378
9	V	A	0.0000
10	L	A	0.4143
11	A	A	0.0000
12	L	A	0.6991
13	Y	A	0.6165
14	D	A	-2.0765
15	Y	A	0.0000
16	Q	A	-1.3420
17	E	A	-1.3023
18	K	A	-1.8547
19	S	A	-0.4287
20	P	A	-0.5623
21	R	A	-1.6489
22	E	A	0.0000
23	V	A	0.0000
24	T	A	-0.2789
25	M	A	0.0000
26	K	A	-2.3116
27	K	A	-2.1641
28	G	A	-0.8612
29	D	A	-0.2431
30	I	A	1.6089
31	L	A	0.0000
32	T	A	0.0800
33	L	A	0.0000
34	L	A	0.3957
35	N	A	-0.6717
36	S	A	-0.2321
37	T	A	-0.2788
38	N	A	-1.3705
39	K	A	-2.2336
40	D	A	-2.0751
41	W	A	-0.0888
42	W	A	0.1073
43	K	A	-0.5262
44	V	A	0.0000
45	E	A	-1.0250
46	V	A	-0.2196
47	N	A	-1.3286
48	G	A	-1.0426
49	R	A	-2.1270
50	Q	A	-1.5350
51	G	A	0.0000
52	F	A	0.3230
53	V	A	0.0000
54	P	A	-0.0062
55	A	A	0.0324
56	A	A	0.1627
57	Y	A	0.5563
58	V	A	0.0000
59	K	A	-1.2969
60	K	A	-1.0616
61	L	A	0.0219
62	D	A	-1.6955