Project name: SH3_I110L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110L
Energy difference between WT (input) and mutated protein (by FoldX)	2.3977 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2565
• Average score: -0.9277
• Total score value: -55.6633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5400
82	S	A	-0.8022
83	H	A	-0.9873
84	M	A	-0.1816
85	T	A	0.0000
86	F	A	0.0000
87	V	A	-0.7219
88	A	A	0.0000
89	L	A	-0.3370
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1637
97	E	A	-2.3623
98	T	A	-1.2597
99	D	A	-1.3606
100	L	A	0.0000
101	S	A	-1.9153
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1313
108	L	A	0.0000
109	Q	A	-0.3808
110	L	A	0.3262	mutated: IA110L
111	V	A	1.2565
112	N	A	-0.3983
113	N	A	-1.8146
114	T	A	-1.7257
115	E	A	-2.9391
116	G	A	-2.6177
117	D	A	-2.7136
118	W	A	-1.3956
119	W	A	-0.7330
120	L	A	0.3950
121	A	A	0.0000
122	H	A	-0.3909
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.5073
130	G	A	0.0000
131	Y	A	0.1383
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3099
135	N	A	-1.2550
136	Y	A	-0.2298
137	V	A	0.0000
138	A	A	-0.0884
139	P	A	-0.3233
140	S	A	-0.3336