Project name: SH3_Y136L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136L
Energy difference between WT (input) and mutated protein (by FoldX)	0.0267055 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4141
• Maximal score value: 1.2498
• Average score: -0.8979
• Total score value: -53.8716

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1179
87	V	A	-0.6132
88	A	A	0.0000
89	L	A	-0.2338
90	Y	A	-0.5419
91	D	A	-2.7416
92	Y	A	-2.0239
93	E	A	-2.8558
94	S	A	0.0000
95	R	A	-2.7783
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3202
100	L	A	0.0000
101	S	A	-1.8866
102	F	A	0.0000
103	K	A	-3.4141
104	K	A	-2.7773
105	G	A	-1.9194
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4371
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8143
114	T	A	-1.7328
115	E	A	-2.9364
116	G	A	-2.6119
117	D	A	-2.6915
118	W	A	-1.3669
119	W	A	-0.7041
120	L	A	0.4014
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2142
132	I	A	0.0000
133	P	A	-0.6005
134	S	A	-1.3448
135	N	A	-1.2989
136	L	A	-0.2820	mutated: YA136L
137	V	A	0.0000
138	A	A	-0.0474
139	P	A	-0.1505
140	S	A	-0.1759