Project name: r1_wo

Status: done

submitted: 2018-11-07 11:40:43, status changed: 2018-11-07 11:48:00
Settings
Chain sequence(s) A: TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.1224
Maximal score value
0.6304
Average score
-0.9153
Total score value
-71.3916

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
103 T A -0.5745
104 S A -0.1783
105 D A -0.3818
106 L A 0.0000
107 I A -0.1438
108 V A 0.0000
109 L A 0.1423
110 G A -0.0201
111 L A 0.0000
112 P A 0.0000
113 W A -0.4450
114 K A -1.7618
115 T A 0.0000
116 T A -1.9961
117 E A -2.5302
118 Q A -2.9485
119 D A -3.1224
120 L A 0.0000
121 K A -2.7485
122 E A -2.9096
123 Y A -1.5110
124 F A 0.0000
125 S A -1.2736
126 T A -0.6581
127 F A -0.7709
128 G A -1.1820
129 E A -1.9585
130 V A 0.0000
131 L A 0.6304
132 M A 0.1537
133 V A -0.8109
134 Q A -1.2596
135 V A 0.0000
136 K A -1.7522
137 K A -1.9703
138 D A -1.4990
139 L A -0.0789
140 K A -1.4672
141 T A -1.1942
142 G A -1.5354
143 H A -2.1132
144 S A -1.8358
145 K A -2.1799
146 G A -0.9190
147 F A -0.1350
148 G A 0.0000
149 F A -0.1568
150 V A 0.0000
151 R A -0.7039
152 F A 0.0000
153 T A -1.0583
154 E A -1.7850
155 Y A -0.6391
156 E A -1.7344
157 T A -1.3144
158 Q A 0.0000
159 V A -0.2217
160 K A -0.9906
161 V A 0.0000
162 M A -0.7393
163 S A -1.1015
164 Q A -1.6334
165 R A -2.1796
166 H A 0.0000
167 M A -0.5647
168 I A 0.0000
169 D A -2.4282
170 G A -1.8037
171 R A -2.0512
172 W A -0.3934
173 C A 0.0000
174 D A -1.0785
175 C A 0.0000
176 K A -1.3319
177 L A 0.0515
178 P A -0.5705
179 N A -1.3117
180 S A -0.7124

 

Laboratory of Theory of Biopolymers 2015