Project name: SH3_G105P

Status: done

submitted: 2019-03-14 15:22:44, status changed: 2019-03-14 16:50:52
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues GA105P
Energy difference between WT (input) and mutated protein (by FoldX) 8.25478 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.0276
Maximal score value
1.2498
Average score
-0.8167
Total score value
-49.0013

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.0397
87 V A -0.4775
88 A A 0.0000
89 L A 0.2347
90 Y A -0.1660
91 D A -1.9523
92 Y A -1.6772
93 E A -2.6992
94 S A 0.0000
95 R A -2.7837
96 T A -2.1541
97 E A -2.3526
98 T A -1.2414
99 D A -1.3230
100 L A 0.0000
101 S A -1.7625
102 F A 0.0000
103 K A -3.0276
104 K A -2.3506
105 P A -1.5575 mutated: GA105P
106 E A 0.0000
107 R A -2.0260
108 L A 0.0000
109 Q A -0.2498
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3867
123 S A 0.0000
124 L A -0.2877
125 T A -0.7685
126 T A -0.8915
127 G A -0.8239
128 Q A -1.4163
129 T A -0.4961
130 G A 0.0000
131 Y A 0.2196
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2013
136 Y A 0.0251
137 V A 0.0000
138 A A 0.0497
139 P A -0.1519
140 S A -0.1774

 

Laboratory of Theory of Biopolymers 2015