Project name: SH3_S134A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134A
Energy difference between WT (input) and mutated protein (by FoldX)	-0.228057 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4824
• Maximal score value: 1.253
• Average score: -0.8914
• Total score value: -53.4854

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0969
87	V	A	-0.6184
88	A	A	0.0000
89	L	A	-0.3089
90	Y	A	-0.7310
91	D	A	-2.8500
92	Y	A	-2.1041
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3226
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4824
104	K	A	-2.8592
105	G	A	-1.9603
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.4488
111	V	A	1.2530
112	N	A	-0.4176
113	N	A	-1.8064
114	T	A	-1.7322
115	E	A	-2.9309
116	G	A	-2.5996
117	D	A	-2.6712
118	W	A	-1.3284
119	W	A	-0.6829
120	L	A	0.4123
121	A	A	0.0000
122	H	A	-0.3824
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4944
130	G	A	0.0000
131	Y	A	0.2265
132	I	A	0.0000
133	P	A	0.0000
134	A	A	-1.2444	mutated: SA134A
135	N	A	-1.2280
136	Y	A	-0.1887
137	V	A	0.0000
138	A	A	-0.0129
139	P	A	-0.1471
140	S	A	-0.1735