Project name: SH3_Y92I

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92I
Energy difference between WT (input) and mutated protein (by FoldX)	7.66007 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4226
• Maximal score value: 1.2501
• Average score: -0.9339
• Total score value: -56.033

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1069
87	V	A	-0.6165
88	A	A	0.0000
89	L	A	-0.2624
90	Y	A	-0.6295
91	D	A	-2.7399
92	I	A	-1.9502	mutated: YA92I
93	E	A	-2.8335
94	S	A	-2.1985
95	R	A	-2.8070
96	T	A	-2.2074
97	E	A	-2.3992
98	T	A	-1.3167
99	D	A	-1.4532
100	L	A	0.0000
101	S	A	-1.8947
102	F	A	0.0000
103	K	A	-3.4226
104	K	A	-2.8062
105	G	A	-1.9475
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4080
113	N	A	-1.7963
114	T	A	-1.7206
115	E	A	-2.9122
116	G	A	-2.5871
117	D	A	-2.6483
118	W	A	-1.2846
119	W	A	-0.6769
120	L	A	0.3988
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4274
129	T	A	-0.5210
130	G	A	0.0000
131	Y	A	0.1746
132	I	A	0.0000
133	P	A	-0.5353
134	S	A	-1.2793
135	N	A	-1.2499
136	Y	A	-0.1855
137	V	A	0.0000
138	A	A	-0.0262
139	P	A	-0.1505
140	S	A	-0.1759