Project name: Insulin

Status: done

submitted: 2019-03-21 16:14:44, status changed: 2019-03-21 16:17:38
Settings
Chain sequence(s) A: GIVEQCCTSICSLYQLENYCN
B: FVNQHLCGSHLVVEALYLVCGERRGFFYTPKA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.3733
Maximal score value
1.5232
Average score
-0.4207
Total score value
-21.4557

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.5154
2 I A 0.0000
3 V A -1.4206
4 E A -2.1431
5 Q A -1.8586
6 C A 0.0000
7 C A -0.8146
8 T A -0.6905
9 S A -0.3688
10 I A 0.3729
11 C A 0.0000
12 S A 0.4562
13 L A 1.0939
14 Y A 1.0351
15 Q A -0.2912
16 L A 0.0000
17 E A -1.2176
18 N A -1.4118
19 Y A -0.5570
20 C A -1.0880
21 N A -1.8006
1 F B 1.2810
2 V B 0.6631
3 N B -0.5205
4 Q B -0.6997
5 H B -0.8325
6 L B 0.0000
7 C B -0.8121
8 G B -0.6378
9 S B -1.0924
10 H B -1.3010
11 L B 0.0000
12 V B 0.0968
13 E B -0.9646
14 A B 0.0000
15 L B 0.0000
16 Y B 1.0205
17 L B 1.2251
18 V B 0.4681
19 C B 0.0000
20 G B -1.0326
21 E B -2.3733
22 R B -2.2640
23 G B -0.7081
24 F B 0.2505
25 F B 1.5232
26 Y B 1.1704
27 T B 0.0048
28 P B -0.9448
29 K B -1.7146
30 A B -1.0415

 

Laboratory of Theory of Biopolymers 2015