Project name: SH3_G81V

Status: done

submitted: 2019-03-14 15:07:32, status changed: 2019-03-14 15:15:32
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues GA81V
Energy difference between WT (input) and mutated protein (by FoldX) 0.496362 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4841
Maximal score value
1.7885
Average score
-0.8069
Total score value
-48.4114

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 V A 1.7885 mutated: GA81V
82 S A 0.4133
83 H A -0.1407
84 M A 0.7523
85 T A 0.0000
86 F A -0.1048
87 V A -0.6245
88 A A 0.0000
89 L A -0.3132
90 Y A -0.7370
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1546
97 E A -2.3532
98 T A -1.2427
99 D A -1.3251
100 L A 0.0000
101 S A -1.9041
102 F A 0.0000
103 K A -3.4841
104 K A -2.8621
105 G A -1.9629
106 E A 0.0000
107 R A -2.0716
108 L A 0.0000
109 Q A 0.0146
110 I A 0.7158
111 V A 1.5299
112 N A -0.4087
113 N A -1.8092
114 T A -1.7294
115 E A -2.9343
116 G A -2.6073
117 D A -2.6850
118 W A -1.3424
119 W A -0.6960
120 L A 0.4072
121 A A 0.0000
122 H A -0.3823
123 S A 0.0000
124 L A -0.2789
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4956
130 G A 0.0000
131 Y A 0.2160
132 I A 0.0000
133 P A 0.0000
134 S A -1.2863
135 N A -1.2485
136 Y A -0.2043
137 V A 0.0000
138 A A -0.0221
139 P A -0.1508
140 S A -0.1767

 

Laboratory of Theory of Biopolymers 2015