Project name: Im7 protein

Status: done

submitted: 2018-11-14 11:11:46, status changed: 2018-11-14 11:18:29
Settings
Chain sequence(s) A: MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.9868
Maximal score value
0.8688
Average score
-1.4218
Total score value
-122.2707

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.1618
2 E A -1.3242
3 L A -0.3561
4 K A -1.1927
5 N A -1.6539
6 S A -1.3864
7 I A 0.0000
8 S A -1.4779
9 D A -1.6147
10 Y A 0.0000
11 T A -1.6386
12 E A -2.2317
13 A A -1.2078
14 E A -1.7666
15 F A 0.0000
16 V A -1.4718
17 Q A -2.0022
18 L A 0.0000
19 L A 0.0000
20 K A -3.2627
21 E A -2.9692
22 I A 0.0000
23 E A -3.4890
24 K A -3.1401
25 E A -2.5720
26 N A -1.9434
27 V A 0.2066
28 A A -0.6435
29 A A -0.3018
30 T A -1.3984
31 D A -2.8176
32 D A -2.6842
33 V A -1.2423
34 L A 0.0000
35 D A -2.7193
36 V A -0.8083
37 L A 0.0000
38 L A -1.0115
39 E A -2.1180
40 H A -1.4190
41 F A 0.0000
42 V A -1.6420
43 K A -2.6000
44 I A 0.0000
45 T A 0.0000
46 E A -2.4244
47 H A 0.0000
48 P A -1.4391
49 D A -1.8937
50 G A -1.6168
51 T A -0.4591
52 D A -0.5615
53 L A 0.0000
54 I A -0.0220
55 Y A 0.8688
56 Y A 0.6221
57 P A -1.2408
58 S A -1.9315
59 D A -2.9911
60 N A -2.9390
61 R A -3.1384
62 D A -3.9868
63 D A -3.1888
64 S A -2.2224
65 P A -2.3276
66 E A -3.0282
67 G A 0.0000
68 I A 0.0000
69 V A 0.0000
70 K A -3.5541
71 E A -2.6188
72 I A 0.0000
73 K A -2.7543
74 E A -2.9168
75 W A -1.9614
76 R A 0.0000
77 A A -1.5791
78 A A -1.2186
79 N A -1.6426
80 G A -1.6669
81 K A -1.9114
82 P A -1.3843
83 G A -1.6526
84 F A -1.4951
85 K A -2.2486
86 Q A -2.0073

 

Laboratory of Theory of Biopolymers 2015