Project name: 8f43f1df3dc641d [mutate: CA182V]

Chain sequence(s)	A: PTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCG
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	CA182V
Energy difference between WT (input) and mutated protein (by FoldX)	1.77558 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.7256
• Maximal score value: 1.773
• Average score: -0.8792
• Total score value: -162.654

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	P	A	0.4197
3	T	A	0.6955
4	I	A	1.7730
5	P	A	0.6988
6	L	A	0.6382
7	S	A	-0.7229
8	R	A	-1.6170
9	L	A	-0.6072
10	F	A	0.0000
11	Q	A	-1.6649
12	N	A	-1.3273
13	A	A	0.0000
14	M	A	0.0000
15	L	A	-0.5600
16	R	A	-1.5889
17	A	A	0.0000
18	H	A	-1.6242
19	R	A	-2.5192
20	L	A	0.0000
21	H	A	-1.7486
22	Q	A	-2.0341
23	L	A	-0.9166
24	A	A	0.0000
25	F	A	-1.1130
26	D	A	-1.0374
27	T	A	-0.7134
28	Y	A	0.0000
29	E	A	-2.5354
30	E	A	-2.0813
31	F	A	-1.0149
32	E	A	-1.5029
33	E	A	-2.3188
34	A	A	-0.7881
35	Y	A	0.2538
36	I	A	0.0311
40	Q	A	-0.7142
41	K	A	-0.2375
42	Y	A	1.1120
43	S	A	0.6724
44	F	A	1.6671
45	L	A	0.4458
46	Q	A	-0.6028
47	A	A	-0.2506
48	P	A	-0.4968
49	Q	A	-0.9671
50	A	A	-0.5683
51	S	A	-0.4479
52	L	A	0.1319
53	C	A	-0.2628
54	F	A	-0.4909
55	S	A	-0.9794
56	E	A	-1.7425
57	S	A	-0.8223
58	I	A	-0.5235
59	P	A	-0.7951
60	T	A	-0.7961
61	P	A	0.0000
62	S	A	-1.9363
63	N	A	-2.9526
64	R	A	-3.6535
65	E	A	-3.7256
66	Q	A	-3.1133
67	A	A	-2.5357
68	Q	A	-2.4998
69	Q	A	-2.6158
70	K	A	-2.5184
71	S	A	-1.5298
72	N	A	-1.4750
73	L	A	0.0000
74	Q	A	-1.1027
75	L	A	0.0000
76	L	A	0.0000
77	R	A	-0.6951
78	I	A	0.1237
79	S	A	0.0000
80	L	A	-0.4797
81	L	A	-0.0411
82	L	A	0.0000
83	I	A	0.0000
84	Q	A	-1.0369
85	S	A	0.0000
86	W	A	0.0000
87	L	A	-0.9855
88	E	A	-1.6290
89	P	A	0.0000
90	V	A	0.0000
91	G	A	-0.2414
92	F	A	1.1031
93	L	A	-0.3514
94	R	A	-1.3565
95	S	A	-0.8940
96	V	A	0.3111
97	F	A	0.0000
98	A	A	-0.3871
99	N	A	-0.4276
100	S	A	0.5217
101	L	A	1.5018
102	V	A	1.1606
103	Y	A	1.2760
104	G	A	0.0518
105	A	A	-0.7393
106	S	A	-1.4361
107	D	A	-2.7468
108	S	A	-2.1942
109	D	A	-2.4633
110	V	A	-1.4140
111	Y	A	-1.0532
112	D	A	-2.2563
113	L	A	0.0000
114	L	A	0.0000
115	K	A	-1.8384
116	D	A	-2.2708
117	L	A	0.0000
118	E	A	-2.1121
119	E	A	-2.8764
120	G	A	-1.7313
121	I	A	0.0000
122	Q	A	-2.2298
123	T	A	-1.4042
124	L	A	0.0000
125	M	A	-1.9042
126	G	A	-2.1849
127	R	A	-2.6833
128	L	A	-2.0659
129	E	A	-3.4938
130	D	A	-3.4164
131	G	A	-1.9639
132	S	A	-1.8303
133	P	A	-2.3513
134	R	A	-2.7071
135	T	A	-1.8831
136	G	A	-1.0618
137	Q	A	-0.9171
138	A	A	-0.1637
139	F	A	0.6837
140	K	A	-1.4037
141	Q	A	-1.5242
142	T	A	-1.1555
143	Y	A	-0.0363
144	A	A	-0.4351
145	K	A	0.2010
146	F	A	0.5656
147	D	A	-1.6258
149	N	A	-2.1635
150	S	A	-1.1346
151	H	A	-2.3219
152	N	A	-3.2077
153	D	A	-3.3012
154	D	A	-3.2800
155	A	A	0.0000
156	L	A	0.0000
157	L	A	-1.1986
158	K	A	-2.1322
159	N	A	0.0000
160	Y	A	0.0000
161	G	A	-0.2498
162	L	A	0.0000
163	L	A	0.0000
164	Y	A	-0.3491
165	C	A	0.0000
166	F	A	0.0000
167	R	A	-1.5106
168	K	A	-1.2488
169	D	A	0.0000
170	M	A	0.0000
171	D	A	-1.0684
172	K	A	0.0000
173	V	A	0.0000
174	E	A	0.0000
175	T	A	-0.4855
176	F	A	0.0000
177	L	A	0.0000
178	R	A	-0.8755
179	I	A	0.0000
180	V	A	0.0000
181	Q	A	-1.2256
182	V	A	-1.0947	mutated: CA182V
183	R	A	-2.2194
184	S	A	-1.2645
185	V	A	-0.9931
186	E	A	-2.1439
187	G	A	-1.4799
188	S	A	-0.5824
189	C	A	-0.1235
190	G	A	-0.5477