Project name: f8ae1e36ef8bdd1 [mutate: PA112H, DA169G, NA267S]

Status: done

submitted: 2018-11-07 09:56:26, status changed: 2018-11-24 16:04:16
Settings
Chain sequence(s) A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation 10 Å
Dynamic mode Yes
Mutated residues PA112H, DA169G, NA267S
Energy difference between WT (input) and mutated protein (by FoldX) 2.20389 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.3286
Maximal score value
2.1151
Average score
-0.7989
Total score value
-134.2101

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
102 K A -1.9031
103 T A -1.2144
104 S A 0.0000
105 D A -0.2057
106 L A 0.0000
107 I A 2.0893
108 V A 0.0000
109 L A 0.9643
110 G A 0.0000
111 L A 0.3856
112 H A -0.9587 mutated: PA112H
113 W A -0.7872
114 K A -1.9913
115 T A -1.5661
116 T A -2.2315
117 E A -3.2960
118 Q A -3.2793
119 D A -2.7962
120 L A 0.0000
121 K A -3.0102
122 E A -2.6663
123 Y A -1.1016
124 F A 0.0000
125 S A -0.8178
126 T A -0.6696
127 F A -0.4182
128 G A 0.0000
129 E A -1.0693
130 V A 0.3231
131 L A 0.0000
132 M A 0.3758
133 V A -0.4607
134 Q A -0.5618
135 V A -0.1579
136 K A -1.1712
137 K A -1.5742
138 D A -1.2588
139 L A -0.2616
140 K A -1.8437
141 T A -1.1408
142 G A -1.4111
143 H A -2.0250
144 S A -1.5211
145 K A -1.8740
146 G A -0.8016
147 F A 0.7172
148 G A 1.2253
149 F A 1.7843
150 V A 0.0000
151 R A 0.4536
152 F A 0.0000
153 T A -0.7112
154 E A -1.1863
155 Y A -0.8722
156 E A -1.7224
157 T A -1.0488
158 Q A 0.0000
159 V A -0.3593
160 K A -1.8632
161 V A 0.0000
162 M A -0.7632
163 S A -1.1203
164 Q A -1.6119
165 R A -1.7575
166 H A -0.5148
167 M A 0.5394
168 I A 0.3282
169 G A -0.4138 mutated: DA169G
170 G A -0.6602
171 R A -0.8509
172 W A 0.0184
173 C A 0.0000
174 D A 0.0000
175 C A 0.0000
176 K A -0.4294
177 L A 0.0000
178 P A -0.6153
179 N A -1.0160
180 S A -1.1374
181 K A -1.5722
182 Q A -1.5859
183 S A -1.3868
184 Q A -1.6473
185 D A 0.0000
186 E A -1.0828
187 P A -0.1608
188 L A 0.9409
189 R A -0.5748
190 S A 0.0000
191 R A -1.8832
192 K A -1.0337
193 V A 0.0000
194 F A 0.5665
195 V A 0.0000
196 G A 0.1468
197 R A 0.0000
198 C A -0.5978
199 T A -1.2431
200 E A -2.5348
201 D A -2.6514
202 M A 0.0000
203 T A -2.0197
204 E A -1.7993
205 D A -3.1976
206 E A -2.8691
207 L A 0.0000
208 R A -2.9598
209 E A -3.2142
210 F A -1.5680
211 F A 0.0000
212 S A -1.8422
213 Q A -1.8211
214 Y A -0.8625
215 G A -1.3250
216 D A -1.7295
217 V A -0.8138
218 M A 0.1318
219 D A 0.1927
220 V A 0.0000
221 F A 2.1151
222 I A 1.4190
223 P A 0.1486
224 K A -1.2465
225 P A -0.3284
226 F A 0.5694
227 R A -0.8227
228 A A 0.0000
229 F A 1.7032
230 A A 0.0000
231 F A 1.4042
232 V A 0.0000
233 T A 0.2458
234 F A 0.0000
235 A A -1.5866
236 D A -2.6483
237 D A -2.4597
238 Q A -2.2157
239 I A -1.5479
240 A A 0.0000
241 Q A -1.2102
242 S A -0.8500
243 L A 0.0000
244 C A -0.3272
245 G A 0.0000
246 E A -0.8112
247 D A 0.0000
248 L A 0.0954
249 I A 0.0448
250 I A 0.0000
251 K A -2.0367
252 G A -0.9497
253 I A 0.0000
254 S A -0.0613
255 V A 0.0000
256 H A -0.2182
257 I A 0.0000
258 S A -0.4384
259 N A -0.6420
260 A A -0.5472
261 E A -1.6478
262 P A -2.1009
263 K A -3.3286
264 H A -2.5962
265 N A -2.9647
266 S A -2.7626
267 S A -2.5721 mutated: NA267S
268 R A -3.0072
269 Q A -2.5343

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.7989 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015