Project name: SH3_N113A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA113A
Energy difference between WT (input) and mutated protein (by FoldX)	-0.0311155 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.5931
• Average score: -0.7962
• Total score value: -47.7711

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4415
82	S	A	-0.6740
83	H	A	-0.7912
84	M	A	0.2782
85	T	A	0.0000
86	F	A	-0.0890
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3223
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0636
108	L	A	0.0000
109	Q	A	-0.2112
110	I	A	0.8109
111	V	A	1.5931
112	N	A	0.2476
113	A	A	-0.4713	mutated: NA113A
114	T	A	-1.0840
115	E	A	-2.4884
116	G	A	-2.2855
117	D	A	-2.4910
118	W	A	-1.0746
119	W	A	-0.1737
120	L	A	0.7439
121	A	A	0.0000
122	H	A	-0.3642
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4869
130	G	A	0.0000
131	Y	A	0.3740
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.0943
135	N	A	-1.2480
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1425
140	S	A	-0.1759